PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Tp57577_TGAC_v2_mRNA24098
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Trifolieae; Trifolium
Family Dof
Protein Properties Length: 353aa    MW: 37593.3 Da    PI: 9.6959
Description Dof family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Tp57577_TGAC_v2_mRNA24098genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-Dof118.91.9e-3773132362
                     zf-Dof   3 ekalkcprCdstntkfCyynnyslsqPryfCkaCrryWtkGGalrnvPvGggrrknkkss 62 
                                e ++kcprCds+ntkfCy+nnyslsqPr+fCk+CrryWt+GGalr vPvGgg+r+nk+++
  Tp57577_TGAC_v2_mRNA24098  73 EPSQKCPRCDSSNTKFCYFNNYSLSQPRHFCKTCRRYWTRGGALRSVPVGGGCRRNKRTK 132
                                56789****************************************************987 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
ProDomPD0074781.0E-3156125IPR003851Zinc finger, Dof-type
PfamPF027011.4E-3175130IPR003851Zinc finger, Dof-type
PROSITE profilePS5088429.08776130IPR003851Zinc finger, Dof-type
PROSITE patternPS01361078114IPR003851Zinc finger, Dof-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 353 aa     Download sequence    Send to blast
MVYTSLPPYM DPANWNQQQP NHQGANTIVN TPLFTTPSQP PPSNLTPSQP HGGSIRPGSM  60
ADRARMANIP MQEPSQKCPR CDSSNTKFCY FNNYSLSQPR HFCKTCRRYW TRGGALRSVP  120
VGGGCRRNKR TKSSSNNTSK SPVSSDRQTS SANNSPAVLS SPTPPPMRFM APLHQLGNHL  180
SEIGLNYGFS GPMGGVGDLN FHIGSSLGGT VGNNSVSGGG GGVSASIIPV GGFEQWRTPQ  240
QTQQFPFLTS LEASSSHGLL YPFEGGGGGG NNQAHIYGGV SKVLSTNSSV KMEENQSRQF  300
LGMINNNNNN NNNPNSEQYW SASNGNGGAT SAWTDLAAFN SSSTTTNSDY RT*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004515618.10.0PREDICTED: dof zinc finger protein DOF2.4-like
TrEMBLA0A072TZB11e-175A0A072TZB1_MEDTR; Dof domain zinc finger protein
STRINGGLYMA08G47290.14e-97(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF65634143
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G37590.12e-41DNA binding with one finger 2.4